Scaffold Ga0188867_1000040

Overview

Basic Information

• Taxon OID: 3300018642
• Scaffold ID: Ga0188867_1000040
• Source Dataset Name: Metatranscriptome of marine microbial communities from Baltic Sea - GS695_0p1
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3500
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 12 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location

• Location Name: Baltic Sea
• Coordinates
  • Lat. (^o): 54.570232
  • Long. (^o): 11.332183
  • Depth (m): 19

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040641	Metagenome / Metatranscriptome	161	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0188867_10000404	F040641	AGGAG	MKTSPIQGMPFEMFQALQMMKYGQPNVYPNSEHIKPPMEKERIRVVEAATRSDLKLNQTRRVEERMQEIQALRDQAAIRYNKDGTTVSPGETQGQFIDLEV