| Basic Information | |
|---|---|
| Taxon OID | 3300018622 Open in IMG/M |
| Scaffold ID | Ga0188862_1020425 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dT |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 620 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Peridiniales → Endodiniaceae → Brandtodinium → Brandtodinium nutricula | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Baltic Sea | |||||||
| Coordinates | Lat. (o) | 54.570232 | Long. (o) | 11.332183 | Alt. (m) | Depth (m) | 15 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F071921 | Metatranscriptome | 121 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0188862_10204251 | F071921 | N/A | HMVQAPAASPEILLGIVGNLSLIHTDGEQVVSSELEAKLYSIAAVHAGTVPLHGRLFAQWMHFAFPLECPYPHVLQDSMSLSPASWTSRNSYTSTEEQRQQFINESAIVADEDIDTLAVHWTDNEVMPLQEPYESRSLFGAVFRGFMHLLMLAVVLKTAAAGMAAVRRVGYGHDKPEKELSCWAAA |
| ⦗Top⦘ |