Scaffold Ga0193064_1014091

Overview

Basic Information

• Taxon OID: 3300018616
• Scaffold ID: Ga0193064_1014091
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003003 (ERX1782367-ERR1711877)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 709
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: North Pacific Ocean: TARA_138
• Coordinates
  • Lat. (^o): 6.3305
  • Long. (^o): -102.9464
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063325	Metatranscriptome	129	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0193064_10140911	F063325	GAG	VSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLHIQTFASASSLICCLE