Scaffold Ga0188846_1010638

Overview

Basic Information

• Taxon OID: 3300018614
• Scaffold ID: Ga0188846_1010638
• Source Dataset Name: Metatranscriptome of marine microbial communities from Baltic Sea - GS678_3p0_dT
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1104
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location

• Location Name: Baltic Sea
• Coordinates
  • Lat. (^o): 58.581234
  • Long. (^o): 18.232801
  • Depth (m): 74

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076820	Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0188846_10106381	F076820	N/A	GFLKRVVKPEDKFEDLSELNHASIRGYALELLQCVADEDDDEFTKAFCIPSSDTALFPKFSLDEMLFSNAWAFPGLTLVSGDQPMELMLEMSSKLRDQFPKLSELEADLKKQEENIKKVEKFKDDDDEGQPRDADSTKLKFSPELVIQSEAFLKKWCPTKPENTHQIARLLPTVTEFLKIKELPVEERWQMLALSGAGSYDPKLDADLANPVYTQWVLDAMNNNKLACVTAGKEFTWGANVPASTVVVTKSFAETTSVAGMLQYVGRAARRGLTTHGQAIFERDEDMDRIFASPDGLSTEALTMERYAAWWLSRGKVW