Scaffold Ga0188821_1013497

Overview

Basic Information

• Taxon OID: 3300018607
• Scaffold ID: Ga0188821_1013497
• Source Dataset Name: Metatranscriptome of freshwater lake microbial communities from Lake Tornetrask, Sweden - GS667_3p0_dT
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 756
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location

• Location Name: Sweden: Lake Tornetrask
• Coordinates
  • Lat. (^o): 68.355835
  • Long. (^o): 18.821667
  • Depth (m): .3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018934	Metagenome / Metatranscriptome	232	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0188821_10134971	F018934	N/A	EQQEYLSELISDGAAKELLEFAKNRLNKFYNPKLYKPPAPRVLTEEEHGVLASGGSLDPTKAPGGIAGTGVTVLQTVTAPPPPPTSIQAYAKQGEGSNGVIAMIDLLIKDLDKSITEAEVTEKDAQKDYESFYQDSADKYAEDSKTLTDKQGVVADLKAALEDQQDSLKTANNEVAGGDLYIHALHLECDWLIKYFDMRKEARDNEIDSLGRAKAVLSGADYSLLQTKTRKYLRGT