NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0188821_1007211

Scaffold Ga0188821_1007211


Overview

Basic Information
Taxon OID3300018607 Open in IMG/M
Scaffold IDGa0188821_1007211 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater lake microbial communities from Lake Tornetrask, Sweden - GS667_3p0_dT
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)975
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location
Location NameSweden: Lake Tornetrask
CoordinatesLat. (o)68.355835Long. (o)18.821667Alt. (m)Depth (m).3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071871Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0188821_10072111F071871N/APRHGPNSFKLDGSIGAQTAAIILDKIDQVRRGFRSLDPRGTGLVSEKDFRKVLYIEGGIPYNDVSIILATAPAKGGFVGYDAWTNEFLTENIPDGSDGKEYEKSSFRVQRPGDAHHGQEIEEIKRVIIENATHLLTTLRLSDFEDTGFISMQDFRGSLYLKCGLNAEQVDSLTCSVKEGQINYPDWIAFFTTNPIMTTTDISQFIRYGGASSTGLRAPELLQNRFSVTGQGPNYCEPVVGMPGVERDTYTTRTQVSDIHTLETLDIRAKLRRREEEVSEELRKEALQRQHEKAVIESPWGVQHTACK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.