Scaffold Ga0188834_1027476

Overview

Basic Information

• Taxon OID: 3300018599
• Scaffold ID: Ga0188834_1027476
• Source Dataset Name: Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dT
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 577
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina brevifila (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location

• Location Name: Baltic Sea
• Coordinates
  • Lat. (^o): 62.09708
  • Long. (^o): 18.5427
  • Depth (m): .3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067275	Metatranscriptome	125	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0188834_10274761	F067275	N/A	HRSVENQMPETGAPATTSSMWAKAGTDWTVDGGTVTSSGMLAEERYAVSGVTISSGVRYFMWKINTSSLPDGHMFLGVADLNGGSVDGQEKCKTWGFSPPTGNLYIGEKLDEHGAEQLKKHFFEDEKESLLDKAPGSSVCMKVDMGEKKLAFSINGSDFIDAGVKLPEGGVRPWCFLYHEGDSVSVAEVDEG