| Basic Information | |
|---|---|
| Taxon OID | 3300018546 Open in IMG/M |
| Scaffold ID | Ga0193014_103495 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002959 (ERX1789637-ERR1719441) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 745 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Pacific Ocean: TARA_136 | |||||||
| Coordinates | Lat. (o) | 17.0854 | Long. (o) | -118.8913 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F071931 | Metatranscriptome | 121 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0193014_1034951 | F071931 | N/A | EEREAQNKEFQTAVSEQRAAQDVLKKALARLKAFYKEKDVQPTLVQEMGFSLIQGKQTPGAAAPPPPPGFEKFEQNKGAAGVMQLIQNVIEDAETMEKDAMTAETDAQAAYVEFITNSNAAIKGDKDAIAMKTEQKTQTIADKETSEADRDASLKDAENLYKTKADLHQACDFLIENFDLRQHARIEEMEALEASKQMFHGADLGM |
| ⦗Top⦘ |