Basic Information | |
---|---|
Taxon OID | 3300018528 Open in IMG/M |
Scaffold ID | Ga0193059_112318 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002171 (ERX1782117-ERR1711864) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 583 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Pacific Ocean: TARA_135 | |||||||
Coordinates | Lat. (o) | 33.0339 | Long. (o) | -121.8782 | Alt. (m) | Depth (m) | 650 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000406 | Metagenome / Metatranscriptome | 1172 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0193059_1123181 | F000406 | N/A | ATEDKQVAWKHLILSFMERYFYLIVFATYAIEFGPSGYEKSFKTYMDEHKELRSMIEEGKDKLEWYRTVDASKLEHLKEIINSPNYKENLGTLIRTIYDFAFMTYADLPRGAIKNNSMRRLAATTLMDILPPDIAERVNKKMEEDPNSTHDFLSLVGLVSYYGGEITA |
⦗Top⦘ |