Basic Information | |
---|---|
Taxon OID | 3300018476 Open in IMG/M |
Scaffold ID | Ga0190274_13005871 Open in IMG/M |
Source Dataset Name | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 566 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Montana | |||||||
Coordinates | Lat. (o) | 45.6356 | Long. (o) | -110.571 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F041803 | Metagenome | 159 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0190274_130058712 | F041803 | N/A | WGRPGMLAWELEYVVGVDGTRIQVQLAGQQNGKSRTGVIAGSAVATGALIFPYSSPVALIWGLKKGEEAVLRGSNVVSAIVKTKTEVAGFQPRPGGPILHDMETVRASTAPLIPTNFERGSVRPKSLKSN |
⦗Top⦘ |