Scaffold Ga0190269_10225191

Overview

Basic Information

• Taxon OID: 3300018465
• Scaffold ID: Ga0190269_10225191
• Source Dataset Name: Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1036
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location

• Location Name: USA: Arizona
• Coordinates
  • Lat. (^o): 33.5944
  • Long. (^o): -109.1397

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011519	Metagenome	290	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0190269_102251911	F011519	AGGAG	MSEQAKKVKHKAIPEWAQGLYYNSGLFSEVLVYHDEESIYFEHL