Scaffold Ga0190275_11182044

Overview

Basic Information

• Taxon OID: 3300018432
• Scaffold ID: Ga0190275_11182044
• Source Dataset Name: Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 840
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location

• Location Name: USA: Montana
• Coordinates
  • Lat. (^o): 45.2639
  • Long. (^o): -110.8632

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010385	Metagenome	304	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0190275_111820442	F010385	AGGAGG	MNHSTAPEPHPSTGEPPRPDQDERPHACNDGWVTIGQTVIDPDTGEATEEFALYLCRRCADAK