| Basic Information | |
|---|---|
| Taxon OID | 3300018432 Open in IMG/M |
| Scaffold ID | Ga0190275_10000371 Open in IMG/M |
| Source Dataset Name | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 41506 |
| Total Scaffold Genes | 36 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 29 (80.56%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Montana | |||||||
| Coordinates | Lat. (o) | 45.2639 | Long. (o) | -110.8632 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051828 | Metagenome | 143 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0190275_1000037120 | F051828 | GGAGG | MEESKPKDLITSSEARSLLRVSRIKMATLLKSGMLRHYANPLDNRVKLVSKAEVLSLIPERAEAA |
| ⦗Top⦘ |