Scaffold Ga0066655_11198768

Overview

Basic Information

• Taxon OID: 3300018431
• Scaffold ID: Ga0066655_11198768
• Source Dataset Name: Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 538
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location

• Location Name: USA: California: Angelo Coastal Reserve
• Coordinates
  • Lat. (^o): 39.7392
  • Long. (^o): -123.6308
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012079	Metagenome / Metatranscriptome	284	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066655_111987681	F012079	N/A	AACATGTQDIADIWAETGEELVWVLAHSIDWIGNNKVLVKQEQGDMLLLLCPDFAHKIARDGIDVPAMQRMLLEWTRAPIERWHRAHWPKLEARGYVEGNVVPLARHPEQFLIAVAGGESGHHALYFCTFGLTWSVSKRFTLDAPYTGGESCELPQPR