Scaffold Ga0187903_10073960

Overview

Basic Information

• Taxon OID: 3300018427
• Scaffold ID: Ga0187903_10073960
• Source Dataset Name: Goat fecal pellet enrichment culture fungal communities from Isla Vista, California, USA - Reed Canary Grass, Gen0, Rep 2, Chloramphenicol
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3309
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Strongyloidea → Strongylidae → Cyathostominae → Cylicostephanus → Cylicostephanus goldi (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 34.4148
  • Long. (^o): -119.8405
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046107	Metagenome / Metatranscriptome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187903_100739604	F046107	N/A	MLENTMYLGKLYYAGIFPFLTNKKEIKPRSNIFKIDSVVSTKLSPDSSFIELLGRDSPFVEIEDDPVLSLCLISTTSTLLVKFGILQYLSNNSSNELLMKGIARAAVNVG