NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181591_10126014

Scaffold Ga0181591_10126014


Overview

Basic Information
Taxon OID3300018424 Open in IMG/M
Scaffold IDGa0181591_10126014 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2071
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F090274Metagenome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0181591_101260145F090274N/AMGSESIQIATSKKDWDDFFAEWDDPQDAIDSMDSYADRVRVACELSGRQIQKTNQRLDESTQEKIRVTIEFEFDR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.