Scaffold Ga0190265_11843288

Overview

Basic Information

• Taxon OID: 3300018422
• Scaffold ID: Ga0190265_11843288
• Source Dataset Name: Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 712
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location

• Location Name: USA: Utah
• Coordinates
  • Lat. (^o): 37.9813
  • Long. (^o): -109.5168

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104595	Metagenome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0190265_118432881	F104595	GGAG	VNRDAKTSSALIALARSRRMQRALAHAHMHRHAPMPTLKSSLGFMTSTACVTDDATTLTHRMALVGVNRNEGVAYVVEELGPNELPIVYRLWLRGPRQGYLVPIHAWYELGNTPEALADIRAKISELAPKLEPVVKTTPEAWMLSTRIVQRRALRVAGPG