NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187770_10417974

Scaffold Ga0187770_10417974


Overview

Basic Information
Taxon OID3300018090 Open in IMG/M
Scaffold IDGa0187770_10417974 Open in IMG/M
Source Dataset NameTropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1055
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location NameColombia: Department of Meta
CoordinatesLat. (o)4.0627Long. (o)-73.195Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033115Metagenome / Metatranscriptome178Y
F089207Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0187770_104179742F033115AGGAGGMRSRILLTILLTALFVIATGCGNVPGCPTCGTTTNGSYTTIDVIPVPEHNPTGEPGGPFNSFDISWINGPTHRDYISDRIGLAVVVIDTVNNVGQCHSGHQCCDQCRKCGQPVCEGC
Ga0187770_104179743F089207N/ARYSGIQANAPAANFLNYYTPGFVPQYDFHTDEITFGINWYLNYWVRYQFNVNIDQLHQPSTTGQLPQNFYALTQELQFRF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.