Scaffold Ga0187771_10354971

Overview

Basic Information

• Taxon OID: 3300018088
• Scaffold ID: Ga0187771_10354971
• Source Dataset Name: Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1233
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location

• Location Name: Colombia: Department of Meta
• Coordinates
  • Lat. (^o): 4.0627
  • Long. (^o): -73.195
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043571	Metagenome / Metatranscriptome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187771_103549712	F043571	AGGAGG	MRTSYRKLAVPGPTLVARGVVILCMMLGLCAFAGAQQGKSAPAKSDLTGHYEGAAKNGAGEVITVTFDLTEKDGAMSGMIHSSHGDFTVTGGSHHGEEVSLEFDAGGPVGTISLKISKDKLAGTWSAGEDGGPVEVKKAAAQEEAPKGKS