NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187771_10075424

Scaffold Ga0187771_10075424


Overview

Basic Information
Taxon OID3300018088 Open in IMG/M
Scaffold IDGa0187771_10075424 Open in IMG/M
Source Dataset NameTropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2674
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location NameColombia: Department of Meta
CoordinatesLat. (o)4.0627Long. (o)-73.195Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022139Metagenome / Metatranscriptome215Y
F027097Metagenome / Metatranscriptome195Y
F066376Metagenome / Metatranscriptome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0187771_100754241F066376N/AKASRMVGPERLAAAVAQYMEWEAFTYWLRSPLESDSKFPDAVAKELQRRCPGFLESDEVLRSTLSPEDYTRRWKALLEWGANRFFSKMQKEGWFDAVMYEARAHPRSVRTVDYWVFYWDEHWSSRPLKAYPSFQEWRRTADNFVVGSGGE
Ga0187771_100754242F022139AGGMRGQGNGNEDHALTGVAAVTDSKRDPVVWSPELDAIIREGYARGCSGAREAINKIQRLHPKWRSHNIWGRAKELGFDQKYVQERPPWSAADDALLLDFAQEQSVKTIARLLHRSEATVRWRFAELGASSRVRDNYTQGELARDLRVSPKTVRRWEAAGFLERRDGRITHESLEEFCRKHASEINCDALDREMQRWLKDCVGFVPAQKQPKNGNGSLKHLQKLGVCPWCSRKTHGNAHGRHVKACARKNGSSKGLQALGSHGHTPVTHSPPDPTTKLSAVRRHSWNEG
Ga0187771_100754243F027097GAGGMSGDFGANPPVWIWQSEGSGTTVETDLLDAARRNWARVLSYAQRYGQDSSIAADILEAVLLAISRAIRASRMLGNPIRNLDSYLYVAFVRRLNRHVARQPKIQFVGSLQDLDAFSGIHTRGSTSTVEDELLVRELLQYMTGRPRDMFFLRTSGYSWKEVARFLGTTANSAQVLFNKGIGTARSRIMKLKASTRWPSEGGEANA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.