NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187771_10001679

Scaffold Ga0187771_10001679


Overview

Basic Information
Taxon OID3300018088 Open in IMG/M
Scaffold IDGa0187771_10001679 Open in IMG/M
Source Dataset NameTropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15003
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (63.16%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location NameColombia: Department of Meta
CoordinatesLat. (o)4.0627Long. (o)-73.195Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000624Metagenome / Metatranscriptome977Y
F002853Metagenome / Metatranscriptome526Y
F015771Metagenome / Metatranscriptome252Y

Sequences

Protein IDFamilyRBSSequence
Ga0187771_1000167915F000624GGAMSPFAIGLLTSFVPVLVQLLLFLRWLHRRMRDDEIIYAFVRDVALNHLPHIYSALQKMAAQQGIVLDETPLVRFLDLDSRAKP
Ga0187771_1000167916F002853AGGAGGMGRAAQNATMNASNQERANIDALNQQFLNQSSQLQNILTPQYQSILNNPGYTPQQQAAITGQSLGALSSAFGSLQQAAQNRAARTRNAAGFGELADELAREKGREAASTTQQNQIAFANNAQQQQMAALQGLSGLYGTNTSLLSRTLGIPAQLLNVNANLAKGGNGFLSSLGSTLGGMLGGLAGGFF
Ga0187771_1000167919F015771N/AANGWFDIAITDNPNAKPGLFYFAESDTTPAFEHPRVYFLGSSRNLYLQLGNQTLYWRAYSQYIGSATSTPVIFGNPPTPVTGGGSSGPPPLPSAGSGALVNGQVCSGNGFGLLGASRLAKMVP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.