| Basic Information | |
|---|---|
| Taxon OID | 3300018086 Open in IMG/M |
| Scaffold ID | Ga0187769_10661628 Open in IMG/M |
| Source Dataset Name | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 789 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Colombia: Department of Meta | |||||||
| Coordinates | Lat. (o) | 4.0627 | Long. (o) | -73.195 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002547 | Metagenome / Metatranscriptome | 549 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0187769_106616281 | F002547 | AGGAGG | MTMAQALHLDIPTPSKLSEAHDFLCEAVILVTDVKSLFSGGSDFAMVARLKDIQSRLADEIWALERLIAAGKPGPRH |
| ⦗Top⦘ |