Scaffold Ga0184628_10007635

Overview

Basic Information

• Taxon OID: 3300018083
• Scaffold ID: Ga0184628_10007635
• Source Dataset Name: Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5193
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location

• Location Name: USA: East River, Colorado
• Coordinates
  • Lat. (^o): 38.9195
  • Long. (^o): -106.9496

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041972	Metagenome / Metatranscriptome	159	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0184628_100076355	F041972	AGG	MRRLGISAAGLLSTLLTLGATAHAAVEAGSDDVPPVSGQAMGKVAVRRGVQGPGGLFTARLLLLINASKDNFGQPTSLAPDLFYSVSDTVQIGLLHTGPMGWQSRPGVGLCLTGTSNGCPKVYNNVGFDFMYGLLFGDFHLSLHSSLFLLFVPEPTLPSGPTEVMWTIGLTGKFHFTDVVALYFDPKVGVVLSHRDLYKEQLFIPVELQFQVGAAVSLKVLSGVSGQLSDLGDTYQVPLGLGLVGNVSRHIDLGLRFSFDNLLGHVDTGVSRTDTRSIGLLLTLRT