Scaffold Ga0180433_10493828

Overview

Basic Information

• Taxon OID: 3300018080
• Scaffold ID: Ga0180433_10493828
• Source Dataset Name: Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 932
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment → Hypersaline Lake Sediment Archaeal Communities From The Salton Sea, California, Usa

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 33.4166
  • Long. (^o): -115.9166
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079712	Metagenome / Metatranscriptome	115	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0180433_104938282	F079712	AGGAGG	MTNIPDSFLPPASQPWGRWVTNGLRNYFRKRDEYDLATQNAIRQLNIAIPQPMRAVLWRQTTGTVTVSVAGTYYPINLAGTLDTDATFNMVASGSPNVTGVKNDTDQARTVVFVATFDGKCGNNNAMGLKLALNGTPIDATECRSFAGSSGQVGKTMTQWIE