NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0184633_10107136

Scaffold Ga0184633_10107136


Overview

Basic Information
Taxon OID3300018077 Open in IMG/M
Scaffold IDGa0184633_10107136 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1444
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9195Long. (o)-106.9496Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038588Metagenome / Metatranscriptome165N
F044994Metagenome / Metatranscriptome153N

Sequences

Protein IDFamilyRBSSequence
Ga0184633_101071362F044994AGGAGMGQVLALSEETYHQLVDLAQRQQRTEEEMLQLCLAAYEAALYERAHQQMLTDGVLVALPAPPLLPGETEEDDDVEPVVLSGTPLSEIILADRR
Ga0184633_101071363F038588AGGAGMTKVLELSDETYQQLADLAQQQQRTPEEMLRVCLATYEAALYERVHQEMVAEGLLEALPTRPLPPDLEDFDPEEIPGRPLSEIILEDRR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.