| Basic Information | |
|---|---|
| Taxon OID | 3300018072 Open in IMG/M |
| Scaffold ID | Ga0184635_10030288 Open in IMG/M |
| Source Dataset Name | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2029 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: East River, Colorado | |||||||
| Coordinates | Lat. (o) | 38.9195 | Long. (o) | -106.9496 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009924 | Metagenome / Metatranscriptome | 311 | Y |
| F072573 | Metagenome / Metatranscriptome | 121 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0184635_100302883 | F072573 | AGGAG | MRLSGSTIFGFILAIGITLTQPYLAFGAGQSFGRSGTSGASRMQGQRSFSDRFNRFGFFGVGGLGDQGDQQVIIIQQFQPAPTAEPSKPAENRIYVQPRWVDGGYGVQVLESGYWTVPK |
| Ga0184635_100302885 | F009924 | N/A | MTVLRALAVLESATMECKKRDINTPEVMEALALLEPHIQPAWLIPQFRHHVGGERENGYQREGQQQVLRPTFEGIRNSVRELVGKKIDALARQFHQTHDMQVKD |
| ⦗Top⦘ |