| Basic Information | |
|---|---|
| Taxon OID | 3300018066 Open in IMG/M |
| Scaffold ID | Ga0184617_1145957 Open in IMG/M |
| Source Dataset Name | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 690 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: East River, Colorado | |||||||
| Coordinates | Lat. (o) | 38.9195 | Long. (o) | -106.9496 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F036869 | Metagenome / Metatranscriptome | 169 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0184617_11459571 | F036869 | GGA | VNVPLIVAGCLAILGAALHGVGGEVLVVRKLSPAMLPPSRFGGPRTTMTMIHTTWHMTTIGYLTVGSALLLAGSAIDGDAAQGLAVLAAGASTG |
| ⦗Top⦘ |