Scaffold Ga0184637_10000124

Overview

Basic Information

• Taxon OID: 3300018063
• Scaffold ID: Ga0184637_10000124
• Source Dataset Name: Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 51865
• Total Scaffold Genes: 46
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 38 (82.61%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location

• Location Name: USA: East River, Colorado
• Coordinates
  • Lat. (^o): 38.9195
  • Long. (^o): -106.9496

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021619	Metagenome / Metatranscriptome	218	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0184637_100001248	F021619	AGG	MRDELLIDLRRTQLLAVDTSLDDARRALLRAARIPSAFAGEIRSLLTVVAELERRVLADAEG