NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187765_10000513

Scaffold Ga0187765_10000513


Overview

Basic Information
Taxon OID3300018060 Open in IMG/M
Scaffold IDGa0187765_10000513 Open in IMG/M
Source Dataset NameTropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)14261
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (92.31%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location NameColombia: Department of Meta
CoordinatesLat. (o)3.8381Long. (o)-73.3194Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007079Metagenome / Metatranscriptome358Y
F054270Metagenome / Metatranscriptome140Y

Sequences

Protein IDFamilyRBSSequence
Ga0187765_100005138F007079GGAGVDPYDVAFPDPSEVAPHAIAFARMMFAHAALEREVRSLVDVINPQTPGFGERPENQWTASESGTGKIIILIKQHRGSGLPQSEQIKNLLNEAIHPCRDRDFLAHGTWCCFNRRSLTIEVRLGQRWGQPELPPENRAYAVRDILKLARKFKDIQVELDKIRRSLEPKMSEAELRAASSFLRRAS
Ga0187765_100005139F054270GGAGMGRILRTDRHRAQASPKRKSQGEIEELREENRRLRELVAHLSKLAVERITETVEPGEPSASDPRAGR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.