NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187887_10424897

Scaffold Ga0187887_10424897


Overview

Basic Information
Taxon OID3300018043 Open in IMG/M
Scaffold IDGa0187887_10424897 Open in IMG/M
Source Dataset NamePeatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)784
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024836Metagenome / Metatranscriptome204Y

Sequences

Protein IDFamilyRBSSequence
Ga0187887_104248971F024836GAGGMTEGREAVRRQVRAPLRLRSRRRWAVTGGVAACWVVLEVVTGSAVSATVLLVALAGLGAGCVGGLRALGITRDHPWIRQLASRPWRDGQDVLKVAMRHLSDVFVVTPSGLLLAPNIVELQLNPDDLSSLCERMELGVINASMAEVYEEQVAAHGARFAGSGRAEVHVIAARSVPPGRYRLRQGDLVSIDAQPDVADAWYADAGPEFAYSVPQHDYAGPGSCVWQAPDSGPTVAGG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.