Basic Information | |
---|---|
Taxon OID | 3300018032 Open in IMG/M |
Scaffold ID | Ga0187788_10379568 Open in IMG/M |
Source Dataset Name | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 590 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Colombia: Department of Meta | |||||||
Coordinates | Lat. (o) | 4.2396 | Long. (o) | -73.2024 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F017333 | Metagenome | 241 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0187788_103795681 | F017333 | N/A | VGRTPLPKDEALQPLNVKVPSEDLYFVQEVLRPMLGVSYNAEAVREVLVQLRTCFRLPRYVVDVLDAEMKAKKVNILGYVQELLLRRYEAIRDRPTRAGQELTGRRPRSR |
⦗Top⦘ |