Scaffold Ga0187886_1040299

Overview

Basic Information

• Taxon OID: 3300018018
• Scaffold ID: Ga0187886_1040299
• Source Dataset Name: Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2254
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location

• Location Name: USA: Minnesota
• Coordinates
  • Lat. (^o): 47.5028
  • Long. (^o): -93.4828

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004193	Metagenome / Metatranscriptome	449	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187886_10402994	F004193	AGGGGG	MPSFPVPKGRRSKRVMSKRRASLVINLDRNQKRLPCLVLDSSKEGFRLRGSFHLRRGQVVELILDENSPRSERCSVVWVGKAGSKQEGELGL