NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187872_10076187

Scaffold Ga0187872_10076187


Overview

Basic Information
Taxon OID3300018017 Open in IMG/M
Scaffold IDGa0187872_10076187 Open in IMG/M
Source Dataset NamePeatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1726
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005065Metagenome / Metatranscriptome413Y
F018222Metagenome / Metatranscriptome236Y

Sequences

Protein IDFamilyRBSSequence
Ga0187872_100761871F018222AGAAGMVRDPRKTWQYFAQAVIQEEDPEKLAYLMRQLYRVLKDNEEPTRSF
Ga0187872_100761872F005065AGGAGMMDANHISERLSSMRIEISDLRVTTARYWSKSQHTALDKSAFASGKGRLLEIKRELSDMMKRCA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.