Scaffold Ga0187810_10027454

Overview

Basic Information

• Taxon OID: 3300018012
• Scaffold ID: Ga0187810_10027454
• Source Dataset Name: Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2076
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment → Coastal Wetland Sediment Microbial Communities From The Mid-Atlantic And Southeast Atlantic Coast Of Usa, Responding To Salinity Intrusion.

Source Dataset Sampling Location

• Location Name: USA: North Carolina
• Coordinates
  • Lat. (^o): 35.9061
  • Long. (^o): -76.1569
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011332	Metagenome / Metatranscriptome	292	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187810_100274544	F011332	N/A	VKELDLEWINAKSVHSSGALTIQIRVTDGGATVQGARLTLRLARPDSAPYYAQVLTDAQGKAEMSVQVDEKSLADSSVLVQANFDGRTATRKFQLRAAL