| Basic Information | |
|---|---|
| Taxon OID | 3300018005 Open in IMG/M |
| Scaffold ID | Ga0187878_1114376 Open in IMG/M |
| Source Dataset Name | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1084 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Minnesota | |||||||
| Coordinates | Lat. (o) | 47.5028 | Long. (o) | -93.4828 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F032508 | Metagenome | 179 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0187878_11143761 | F032508 | N/A | LRVPEAMQEAVIKLLASGGFLDSLAEVIKQNGEIFGAYRAVGQGGIAERVMQAMTGSVRFVKNESAEQVGGALERALQAGHPVVACSGGSQYFQELAEGRGLPADTKSWYVNAHCYTALAYDGKGRTVTLRNPWASFPQPDGVFTLPLQTFVPAFRGIITTQQ |
| ⦗Top⦘ |