Scaffold Ga0187816_10027610

Overview

Basic Information

• Taxon OID: 3300017995
• Scaffold ID: Ga0187816_10027610
• Source Dataset Name: Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2280
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment → Coastal Wetland Sediment Microbial Communities From The Mid-Atlantic And Southeast Atlantic Coast Of Usa, Responding To Salinity Intrusion.

Source Dataset Sampling Location

• Location Name: USA: North Carolina
• Coordinates
  • Lat. (^o): 35.9061
  • Long. (^o): -76.1569
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001953	Metagenome / Metatranscriptome	612	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187816_100276103	F001953	AGGAGG	MKKFGLFLPILAITLMLGGNAFATVIEGGDGSYYFVTYYSNANTSGAPDGTLRIINDGDQATTAPEGVENGQLWAAIYVFDDSQEMRSCCACLITSDGLLSESVNKELTADEFTGRGEMTRGVIKVISSAVPYPATPSPLTGLRGWMTHIQATTTTFPSGAGNDANAVEKGPWFVTETALADSNLSGTELSNLGALCSYGLTIGSGYGSCPCTPEDYDF