Scaffold Ga0180435_10335694

Overview

Basic Information

• Taxon OID: 3300017992
• Scaffold ID: Ga0180435_10335694
• Source Dataset Name: Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_1 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1249
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium GW2011_GWF2_44_8b (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment → Hypersaline Lake Sediment Archaeal Communities From The Salton Sea, California, Usa

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 33.3
  • Long. (^o): -115.8
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024972	Metagenome / Metatranscriptome	203	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180435_103356941	F024972	GGGGG	MKITKVTKKYFETEGERVYFFEPLDEEMTVKELQELMDEHEKFILEQIRNMRKEKKNETV