Scaffold Ga0180431_10026634

Overview

Basic Information

• Taxon OID: 3300017987
• Scaffold ID: Ga0180431_10026634
• Source Dataset Name: Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5699
• Total Scaffold Genes: 13
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (38.46%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-KM21-C345 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment → Hypersaline Lake Sediment Archaeal Communities From The Salton Sea, California, Usa

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 33.4166
  • Long. (^o): -115.9166
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042288	Metagenome / Metatranscriptome	158	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180431_100266342	F042288	N/A	MKGKVKVIVRVAAEHPDAETFKCLGNKVVLKAESYDHAFEFALTILNLRDSKMFEHGDLMFFNEGILIEIDR