Scaffold Ga0187777_10696634

Overview

Basic Information

• Taxon OID: 3300017974
• Scaffold ID: Ga0187777_10696634
• Source Dataset Name: Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 720
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location

• Location Name: Colombia: Department of Meta
• Coordinates
  • Lat. (^o): 3.8381
  • Long. (^o): -73.3194
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083282	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187777_106966341	F083282	N/A	RCILRETGTIEACHVLDSRGPPYDEAIEAWLARRVYTPVAYKGRAVLVPYTFLVSLTPPPGETARIAAVRLEVFRALLTRLRGPPVDAGGARPLVCVGVGDDVADPPRSDLEALARAGAQVEPASSCWGLMQTVGNAAPFGSIVVREVRFERPDVAEVRAELGISGQTPEYLVLRVSRLGGSWLVEEVPPLGDAGTP