NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187781_10000007

Scaffold Ga0187781_10000007


Overview

Basic Information
Taxon OID3300017972 Open in IMG/M
Scaffold IDGa0187781_10000007 Open in IMG/M
Source Dataset NameTropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)190235
Total Scaffold Genes183 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)136 (74.32%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location NameColombia: Department of Meta
CoordinatesLat. (o)4.0627Long. (o)-73.195Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016370Metagenome / Metatranscriptome247Y
F025789Metagenome / Metatranscriptome200Y
F084998Metagenome / Metatranscriptome111Y
F085937Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0187781_10000007100F084998N/AMAKAAPKSKSAMDVLVDSFTELVEGARQRMTPEEFQKAEKEFDGIIDKAKARASRAGRRETA
Ga0187781_1000000726F016370GGAGMGRRDFRRMVSSVLLVLFPAAMYAADSNPAMLYTNGAAWVNGAHVPRTSTAIFEGDLLQTRFDGVAKINETGSSVTVQPDSLVKFEGASVRIEHGAVAVSTSREMATTAGDVKVKPVSASWTEFNVEDVDGTVRIAALKGDLTITDGKEVMTLAQGQETTRDEKSSEDTDNQDQDHKKHDKRRAGAIAPAEGGILNNPVVVGAGGVAIVTTGIIVLLQHGNPVSPSDP
Ga0187781_1000000757F025789GAGGMRLGVVLGAPVIVALLGIQTFAGPFVVFPKAGQLVSPDGRFVVRNVEREAKATEFAGNFRSLWLTEIHTGRTRKLCDYVGIAAVAWSGNDSLIVTQYLTQETSRALIFSVTVAEEPIVVDVPGLIRLVPAELRPALKENDHVFVEASRLEGESLFFRVWGYGKHDADGFRWRCEYNLNSGTVSCSEEHARR
Ga0187781_1000000799F085937AGGAGMRARWRPPKELRTDTAMLRRKAELAEKLAFAVEHGTEEEFAAAVKKFKPGVGKEELKDWIMRFHDARREKRGL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.