| Basic Information | |
|---|---|
| Taxon OID | 3300017971 Open in IMG/M |
| Scaffold ID | Ga0180438_11208104 Open in IMG/M |
| Source Dataset Name | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 545 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment → Hypersaline Lake Sediment Archaeal Communities From The Salton Sea, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 33.3 | Long. (o) | -115.8 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047656 | Metagenome | 149 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0180438_112081042 | F047656 | AGG | MTIEQLKKLMKDLGASEETTSDGFTFIELDSKNLKCPEASKGCAADGWPKAWPKYKKKGGKYVYKR |
| ⦗Top⦘ |