Scaffold Ga0180438_10100914

Overview

Basic Information

• Taxon OID: 3300017971
• Scaffold ID: Ga0180438_10100914
• Source Dataset Name: Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2475
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment → Hypersaline Lake Sediment Archaeal Communities From The Salton Sea, California, Usa

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 33.3
  • Long. (^o): -115.8
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006940	Metagenome / Metatranscriptome	361	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180438_101009146	F006940	AGGAGG	MKRLSLDDISNAPSLPEKEIEIPEWDATVLVTGLTKADAVEINELSEKDGVRDEVLFEKHLLIKGLKEPQFDDLDQVEEFYSKATPSIVDKVLIGIYRCMAWTKEDQASIASEFPE