| Basic Information | |
|---|---|
| Taxon OID | 3300017965 Open in IMG/M |
| Scaffold ID | Ga0190266_11308870 Open in IMG/M |
| Source Dataset Name | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 510 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Utah | |||||||
| Coordinates | Lat. (o) | 37.9013 | Long. (o) | -109.5337 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F075810 | Metagenome / Metatranscriptome | 118 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0190266_113088702 | F075810 | N/A | LETTETLSSDLRAAAPTYLEDVNERGIVMLVTRHKDQSQFSRYFYPWSVIGWIRLAEEDERS |
| ⦗Top⦘ |