NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0180437_10868871

Scaffold Ga0180437_10868871


Overview

Basic Information
Taxon OID3300017963 Open in IMG/M
Scaffold IDGa0180437_10868871 Open in IMG/M
Source Dataset NameHypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)649
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment → Hypersaline Lake Sediment Archaeal Communities From The Salton Sea, California, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.3Long. (o)-115.8Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010318Metagenome / Metatranscriptome305Y
F032867Metagenome / Metatranscriptome179Y

Sequences

Protein IDFamilyRBSSequence
Ga0180437_108688711F032867N/AMDELEKMIDDLIDNHYRVQHLIGTEADESEYLADISEEDDEDLD
Ga0180437_108688713F010318AGGAGGMNVDSDKPRYLECIYEAPITFDLEELGIDWDNVKDYYIKYGTLHVDFKDGTSESYYNADVGETDYKWAVRESILTEDYDLVEGLN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.