NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181577_10365520

Scaffold Ga0181577_10365520


Overview

Basic Information
Taxon OID3300017951 Open in IMG/M
Scaffold IDGa0181577_10365520 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)924
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006383Metagenome374Y
F022555Metagenome214Y

Sequences

Protein IDFamilyRBSSequence
Ga0181577_103655202F022555AGGAGMAITPKFKPGQLVKYNHPANKLVGLVKSTQFARRRGDPVLVLVQWCGKYRNSEEYVYQKDLKLVEEV
Ga0181577_103655203F006383GGAGGMLNSTDKMWAVQQPGTILRSRWGNENYGKLALVLARAYDGPKPSNGYPPRRYVKMQWITSGERFEEMLVNAHNCFDIVSSCDTIRR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.