NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181607_10008956

Scaffold Ga0181607_10008956


Overview

Basic Information
Taxon OID3300017950 Open in IMG/M
Scaffold IDGa0181607_10008956 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8215
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (68.42%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009597Metagenome / Metatranscriptome315Y
F050275Metagenome / Metatranscriptome145N
F058189Metagenome / Metatranscriptome135N

Sequences

Protein IDFamilyRBSSequence
Ga0181607_1000895618F050275AGGAMTNNEDILVFDYDFDKSALLDFWNQNQDNSQPYTDKRFGKFVMNNWRILNDIELEYADKLNKYFDIDTLPKFYILKANTKLLPHIDYDTTCSINFLLSDGAAPVRFGDNEYYYRTALLNTTRKHSVDKHPADRLLFKLSVKYESFDSVKQKILNTISRS
Ga0181607_100089562F009597AGAAGMVCLDGKDDWIYVTKQTEHCWDLQPELFEDAHEAMEFAKTFQHPDRPEMVMVVDYYEDP
Ga0181607_100089567F058189GAGMKFSCPIDFHLPTQKLHDIYWNEFGYKLDDRTLYKDDKRIMPVVTGFLITGKDIKWPVQSLLDALDIELQTARLFVTNPHCKLQIHKDCLAQSKELRSWAINIPIANCDLGINEWFEDHNNNFGTEQFAPGGSAIIPEYFDNNYIVSESIVLNSIQLIKTNVFHRSNNTGNDNRRVVLSLRGKPDVTWADILEKVNVYNRRRAEDNS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.