NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181607_10002266

Scaffold Ga0181607_10002266


Overview

Basic Information
Taxon OID3300017950 Open in IMG/M
Scaffold IDGa0181607_10002266 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)16975
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)19 (90.48%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011949Metagenome / Metatranscriptome285Y
F012991Metagenome / Metatranscriptome275Y

Sequences

Protein IDFamilyRBSSequence
Ga0181607_1000226610F012991GAGGMAYIYPAPGVSGVQATLSISIASNGSDTGLTVPALQDVTVNNANDVFTWTQLDSGSKQQIATTATNSLGMNLVLEQTSFFGDSTATTGTAAESGMFGLSKNKTKVSFELYLGDTDGGATGKTISGDGYITGLAPTVSADAPVWVSPITVTVDGDYTVS
Ga0181607_100022668F011949GGAGMSFIIENNVTISFADYQDVVDKDQRLFEANEGLTDDVVEDGLIRATERILSRLRSSSWWQSYYTRRNTTNSISSVADIPAVDPDKIKARLNDFRDLCVYVGLSDYILPSIADFGSEENAERNKMGYYNNKGDALFGELITAGDWYDFDDDDTIASSEKQPGQYNLKRIR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.