Scaffold Ga0187814_10154001

Overview

Basic Information

• Taxon OID: 3300017932
• Scaffold ID: Ga0187814_10154001
• Source Dataset Name: Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 857
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment → Coastal Wetland Sediment Microbial Communities From The Mid-Atlantic And Southeast Atlantic Coast Of Usa, Responding To Salinity Intrusion.

Source Dataset Sampling Location

• Location Name: USA: North Carolina
• Coordinates
  • Lat. (^o): 35.9061
  • Long. (^o): -76.1569
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012596	Metagenome / Metatranscriptome	279	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187814_101540011	F012596	GGAG	MLALKYLLMILGVGLFGSAAALVTYDIFLSAQLLRLLRRNKTDEPGAEVAPLVKRPFRPVRWRLALQLALAGAL