| Basic Information | |
|---|---|
| Taxon OID | 3300017932 Open in IMG/M |
| Scaffold ID | Ga0187814_10115549 Open in IMG/M |
| Source Dataset Name | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 993 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment → Coastal Wetland Sediment Microbial Communities From The Mid-Atlantic And Southeast Atlantic Coast Of Usa, Responding To Salinity Intrusion. |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: North Carolina | |||||||
| Coordinates | Lat. (o) | 35.9061 | Long. (o) | -76.1569 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026059 | Metagenome / Metatranscriptome | 199 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0187814_101155491 | F026059 | AGAAGG | MTAPIIALPASNPDGIPARKKRVLLVDTSQTKRDLRADVMRKLGIEVDCAADVLEARCWWRADLYNLVLINVDGETDSRDRFCTDVRSAIPAQKIAFF |
| ⦗Top⦘ |