| Basic Information | |
|---|---|
| Taxon OID | 3300017815 Open in IMG/M |
| Scaffold ID | Ga0188954_12039 Open in IMG/M |
| Source Dataset Name | Saline water viral communities from hypersaline pond near village of Ngallou, Senegal ? P5 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | GATC-Biotech AG, Konstanz, Germany |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1108 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Saline Water → Archevir - Metagenome And Diversity Of Hyperhalophilic Archaeoviruses |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | village of Ngallou, Senegal | |||||||
| Coordinates | Lat. (o) | 14.0491 | Long. (o) | -16.7624 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042291 | Metagenome | 158 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0188954_120392 | F042291 | GAGG | MPIYQAYNKRIGAWVKYEFGKKGWKALNVKEREPKKPFKGIPRKGQKR |
| ⦗Top⦘ |